Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Beta-defensin 131B (D131B), Biotinylated

This Recombinant Human Beta-defensin 131B (D131B), Biotinylated spans the amino acid sequence from region 23-70. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Beta-defensin 131B; Defensin, beta 131; DEFB131B

UniProt

A0A096LNP1

Expression Region

23-70

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

FTSNDECPSEYYHCRLKCNADEHAIRYCADFSICCKLKIIQIDGQKKW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NKX2.8 (NKX28/2548), CF488A conjugate, 0.1mg/mL
BNC882548-100 1x 100 µL

NKX2.8 (NKX28/2548), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
AP2 gamma (TFAP2C) Rabbit Polyclonal Antibody
TA382449 100 µL

AP2 gamma (TFAP2C) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dilinoleyl DiI
#60034 1x 5 mg

Dilinoleyl DiI

Sign In for Pricing
View Details
LYRIC (MTDH) (NM_178812) Human Recombinant Protein
TP307238 20 µg

LYRIC (MTDH) (NM_178812) Human Recombinant Protein

Sign In for Pricing
View Details
3-Amino-2,4-xylenol
TRC-A632430-10MG 10 mg

3-Amino-2,4-xylenol

Sign In for Pricing
View Details
Ubash3a Mouse Gene Knockout Kit (CRISPR)
KN518557 1 Kit

Ubash3a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details