Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda joining 1 (LJ01), Biotinylated

This Recombinant Human Immunoglobulin lambda joining 1 (LJ01), Biotinylated spans the amino acid sequence from region 1-42. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda joining 1 IGLJ1

UniProt

A0A0A0MT76

Expression Region

1-42

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PSRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) Human shRNA Plasmid Kit (Locus ID 1137)
TG313920 1 Kit

Nicotinic Acetylcholine Receptor alpha 4 (CHRNA4) Human shRNA Plasmid Kit (Locus ID 1137)

Sign In for Pricing
View Details
MMACHC (NM_015506) Human Tagged Lenti ORF Clone
RC223846L4 10 µg

MMACHC (NM_015506) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Adenylate kinase 2 Recombinant Protein
PROTP54819-100ug 100 µg

Human Adenylate kinase 2 Recombinant Protein

Sign In for Pricing
View Details
Hemopexin (h) -PR
sc-60778-PR 10 µM - 20 µL

Hemopexin (h) -PR

Sign In for Pricing
View Details
Rabbit Polyclonal GLMN Antibody
NBP2-14054 0.1 mL

Rabbit Polyclonal GLMN Antibody

Sign In for Pricing
View Details
Muscle FBPase (E-11) Alexa Fluor® 594
sc-390209 AF594 200 µg/mL

Muscle FBPase (E-11) Alexa Fluor® 594

Sign In for Pricing
View Details