Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda joining 1 (LJ01), Biotinylated

This Recombinant Human Immunoglobulin lambda joining 1 (LJ01), Biotinylated spans the amino acid sequence from region 1-42. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda joining 1 IGLJ1

UniProt

A0A0A0MT76

Expression Region

1-42

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PSRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human STX1A Recombinant Protein
PPT-15516 100 µg

Human STX1A Recombinant Protein

Sign In for Pricing
View Details
Mxra8 (NM_001007002) Rat Tagged ORF Clone
RR215685 10 µg

Mxra8 (NM_001007002) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Mouse IgG (Fc) Antibody (FITC)
GWB-477689 1 mg

Mouse IgG (Fc) Antibody (FITC)

Sign In for Pricing
View Details
ZNF529 Antibody - N-terminal region
ARP35986_P050-25UL 25 µL

ZNF529 Antibody - N-terminal region

Sign In for Pricing
View Details
Goat S100 Calcium Binding Protein ELISA Kit
MBS743820-01 48 Well

Goat S100 Calcium Binding Protein ELISA Kit

Sign In for Pricing
View Details
Goat S100 Calcium Binding Protein ELISA Kit
MBS743820-02 96 Well

Goat S100 Calcium Binding Protein ELISA Kit

Sign In for Pricing
View Details