Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein MMP24OS (MMPOS), Biotinylated

This Recombinant Human Protein MMP24OS (MMPOS), Biotinylated spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein MMP24OS; MMP24 opposite strand; MMP24OS MMP24-AS1

UniProt

A0A0U1RRL7

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGAQLSGGRGAPEPAQTQPQPQPQPAAPEGPEQPRHPPQPQPQPQPQPQPEPSPWGPLDDVRFLIACTSWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Liver Canuliculi (HSA98), CF740 conjugate, 0.1mg/mL
BNC740098-500 1x 500 µL

Liver Canuliculi (HSA98), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD62L (L-Selectin) (CD62L/1588), CF640R conjugate, 0.1mg/mL
BNC401588-500 1x 500 µL

CD62L (L-Selectin) (CD62L/1588), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C18orf56 (TYMSOS) (NM_001012716) Human Over-expression Lysate
LC422818 20 µg

C18orf56 (TYMSOS) (NM_001012716) Human Over-expression Lysate

Sign In for Pricing
View Details
Biotin-TEG Azide
TRC-B391600-25MG 25 mg

Biotin-TEG Azide

Sign In for Pricing
View Details
RBJ (DNAJC27) (NM_001198559) Human Over-expression Lysate
LY434021 100 µg

RBJ (DNAJC27) (NM_001198559) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytotoxicity Control Reagent (Saponin)
CTTX-050 50 mg

Cytotoxicity Control Reagent (Saponin)

Sign In for Pricing
View Details