Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein MMP24OS (MMPOS), Biotinylated

This Recombinant Human Protein MMP24OS (MMPOS), Biotinylated spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein MMP24OS; MMP24 opposite strand; MMP24OS MMP24-AS1

UniProt

A0A0U1RRL7

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGAQLSGGRGAPEPAQTQPQPQPQPAAPEGPEQPRHPPQPQPQPQPQPQPEPSPWGPLDDVRFLIACTSWY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRT87P Rabbit Polyclonal Antibody (HRP)
orb2105090 100 µL

KRT87P Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Phospho-PLM (S68) Antibody
AM1120a 400 µL

Phospho-PLM (S68) Antibody

Sign In for Pricing
View Details
Recombinant Human Annexin A11
7-04348 5 µg

Recombinant Human Annexin A11

Sign In for Pricing
View Details
Rabbit Anti-MIEF1 antibody
SL12634R-01 50 µL

Rabbit Anti-MIEF1 antibody

Sign In for Pricing
View Details
Rabbit Anti-MIEF1 antibody
SL12634R-02 100 µL

Rabbit Anti-MIEF1 antibody

Sign In for Pricing
View Details
Invs (NM_001107932) Rat Tagged Lenti ORF Clone
RR203853L4 10 µg

Invs (NM_001107932) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details