Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Late cornified envelope protein 6A (LCE6A), Biotinylated

This Recombinant Human Late cornified envelope protein 6A (LCE6A), Biotinylated spans the amino acid sequence from region 1-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Late cornified envelope protein 6A LCE6A C1orf44

UniProt

A0A183

Expression Region

1-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Velmupressin
HY-P1809 1 Each

Velmupressin

Sign In for Pricing
View Details
TRIM41 Peptide
orb2019915 100 µg

TRIM41 Peptide

Sign In for Pricing
View Details
FBS Good, EU approved regions, filtrated bovine serum, 0.2 µm sterile filtered
P40-37100 100 mL

FBS Good, EU approved regions, filtrated bovine serum, 0.2 µm sterile filtered

Sign In for Pricing
View Details
Chst11 (NM_001108079) Rat Tagged Lenti ORF Clone
RR215236L3 10 µg

Chst11 (NM_001108079) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 Transcriptional regulatory protein BaeR (baeR)
MBS1146737-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6 Transcriptional regulatory protein BaeR (baeR)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 Transcriptional regulatory protein BaeR (baeR)
MBS1146737-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O6 Transcriptional regulatory protein BaeR (baeR)

Sign In for Pricing
View Details