Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C20orf204 (CT204), Biotinylated

This Recombinant Human Uncharacterized protein C20orf204 (CT204), Biotinylated spans the amino acid sequence from region 24-189. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C20orf204 C20orf204 PRR17

UniProt

A0A1B0GTL2

Expression Region

24-189

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

YSPACSVPDVLRHYRAIIFEDLQAAVKWGGAGAEKTRPGSRHFHFIQKNLTRPGSSGRRGRPRASCGAQKEHSILLSISSLGRTLRGAVAGGRRGALERAAWTVAVRTEAVMRRHCRTLRQRSRRPKMRPARRRGGRRQLLLRALDAVATCWEKLFALRAPASRDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LYPD3 Polyclonal Antibody
E-AB-90983-01 60 µL

LYPD3 Polyclonal Antibody

Sign In for Pricing
View Details
LYPD3 Polyclonal Antibody
E-AB-90983-02 120 µL

LYPD3 Polyclonal Antibody

Sign In for Pricing
View Details
LYPD3 Polyclonal Antibody
E-AB-90983-03 200 µL

LYPD3 Polyclonal Antibody

Sign In for Pricing
View Details
DNMT3A (NM_022552) Human Recombinant Protein
TP313064 20 µg

DNMT3A (NM_022552) Human Recombinant Protein

Sign In for Pricing
View Details
Human DARS2 activation kit by CRISPRa
GA110561 1 Kit

Human DARS2 activation kit by CRISPRa

Sign In for Pricing
View Details
CINP Human qPCR Primer Pair (NM_032630)
HP231703 200 Reactions

CINP Human qPCR Primer Pair (NM_032630)

Sign In for Pricing
View Details