Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Epididymal protein 13 (EDD13), Biotinylated

This Recombinant Human Epididymal protein 13 (EDD13), Biotinylated spans the amino acid sequence from region 24-161. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epididymal protein 13 EDDM13

UniProt

A0A1B0GTR0

Expression Region

24-161

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

CTPREVATKEKINLLKGIIGLMSRLSPDGLRHNITSLKMPPLVSPQDRTEEEIKKILGLLSLQVLHEETSGCKEEVKPFSGTTPSRKPLPKRKNTWNFLKCAYMVMTYLFVSYNKGDWCYCHYCNLELDIRDDPCCSF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Cortisol, FT4 ELISA Kit
MBS1609102 96 Well

Sheep Cortisol, FT4 ELISA Kit

Sign In for Pricing
View Details
LSM5 Rabbit pAb, PE-Cy5.5 conjugated
orb2868696 100 µL

LSM5 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
SLC7A8 Antibody - N-terminal region : HRP (ARP72881_P050-HRP)
ARP72881_P050-HRP 100 µL

SLC7A8 Antibody - N-terminal region : HRP (ARP72881_P050-HRP)

Sign In for Pricing
View Details
Adrenomedullin, Human
301857 100 µg

Adrenomedullin, Human

Sign In for Pricing
View Details
Mouse Monoclonal FKBP51/FKBP5 Antibody (OTI3E9) [Janelia Fluor 549]
NBP2-70742JF549 0.1 mL

Mouse Monoclonal FKBP51/FKBP5 Antibody (OTI3E9) [Janelia Fluor 549]

Sign In for Pricing
View Details
RPL17P13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1913608 1.0 µg DNA

RPL17P13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details