Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 50 (TEX50), partial, Biotinylated

This Recombinant Human Testis-expressed protein 50 (TEX50), partial, Biotinylated spans the amino acid sequence from region 96-177. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 50 TEX50

UniProt

A0A1B0GTY4

Expression Region

96-177

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Svop Mouse Monoclonal Antibody [Clone ID: N356/23]
75-353 100 µL

Svop Mouse Monoclonal Antibody [Clone ID: N356/23]

Sign In for Pricing
View Details
ARF1 (Golgi Apparatus Marker) (1A9/5), CF405S conjugate, 0.1mg/mL
BNC042028-500 1x 500 µL

ARF1 (Golgi Apparatus Marker) (1A9/5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Doublecortin (Ab-297) Antibody
8B0637-AAT 50 µg

Doublecortin (Ab-297) Antibody

Sign In for Pricing
View Details
EPLIN (LIMA1) Mouse Monoclonal Antibody [Clone ID: OTI1B4]
CF808565 100 µg

EPLIN (LIMA1) Mouse Monoclonal Antibody [Clone ID: OTI1B4]

Sign In for Pricing
View Details
CLIC5 Human qPCR Primer Pair (NM_016929)
HP227151 200 Reactions

CLIC5 Human qPCR Primer Pair (NM_016929)

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS636976 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details