Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 50 (TEX50), partial, Biotinylated

This Recombinant Human Testis-expressed protein 50 (TEX50), partial, Biotinylated spans the amino acid sequence from region 96-177. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 50 TEX50

UniProt

A0A1B0GTY4

Expression Region

96-177

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HYLWKKWKKHQKKLKKQASLEKPGNDLESPLINNIDQTLHRVATTASVIYKIWEHRSHHPSSKKIKHCKLKKKSKEEGARRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NUF2 Human Gene Knockout Kit (CRISPR)
KN203340RB 1 Kit

NUF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human URG4 (URGCP) activation kit by CRISPRa
GA110867 1 Kit

Human URG4 (URGCP) activation kit by CRISPRa

Sign In for Pricing
View Details
Floor Standing Shaking Incubator BSFT-1801
BSFT-1801 1 Unit

Floor Standing Shaking Incubator BSFT-1801

Sign In for Pricing
View Details
Rozanolixizumab Biosimilar - Research Grade
ICH5051-10mg 10 mg (2x 5 mg)

Rozanolixizumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Nicotine N-beta-D-Glucuronide
TRC-N424575-1MG 1 mg

Nicotine N-beta-D-Glucuronide

Sign In for Pricing
View Details
USP7 Antibody
KC-28069-01 50 μL

USP7 Antibody

Sign In for Pricing
View Details