Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 196 (CC196), Biotinylated

This Recombinant Human Coiled-coil domain-containing protein 196 (CC196), Biotinylated spans the amino acid sequence from region 1-297. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 196; Long intergenic non-protein coding RNA 238; CCDC196 C14orf53 LINC00238 NCRNA00238

UniProt

A0A1B0GTZ2

Expression Region

1-297

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTSGANSSGSYLPSEIRSSKIDDNYLKELNEDLKLRKQELLEMLKPLEDKNNLLFQKLMSNLEEKQRSLQIMRQIMAGKGCEESSVMELLKEAEEMKQNLERKNKMLRKEMEMLWNKTFEAEELSDQQKAPQTKNKADLQDGKAPKSPSSPRKTESELEKSFAEKVKEIRKEKQQRKMEWVKYQEQNNILQNDFHGKVIELRIEALKNYQKANDLKLSLYLQQNFEPMQAFLNLPGSQGTMGITTMDRVTTGRNEHHVRILGTKIYTEQQGTKGSQLDNTGGRLFFLRSLPDEALKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) CLIA Kit
E-CL-H0832-01 24 Tests

Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) CLIA Kit

Sign In for Pricing
View Details
Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) CLIA Kit
E-CL-H0832-02 48 Tests

Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) CLIA Kit

Sign In for Pricing
View Details
Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) CLIA Kit
E-CL-H0832-03 96 Tests

Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) CLIA Kit

Sign In for Pricing
View Details
SLC23A1 Polyclonal Antibody
E-AB-90123-01 60 µL

SLC23A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC23A1 Polyclonal Antibody
E-AB-90123-02 120 µL

SLC23A1 Polyclonal Antibody

Sign In for Pricing
View Details
SLC23A1 Polyclonal Antibody
E-AB-90123-03 200 µL

SLC23A1 Polyclonal Antibody

Sign In for Pricing
View Details