Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 196 (CC196), Biotinylated

This Recombinant Human Coiled-coil domain-containing protein 196 (CC196), Biotinylated spans the amino acid sequence from region 1-297. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 196; Long intergenic non-protein coding RNA 238; CCDC196 C14orf53 LINC00238 NCRNA00238

UniProt

A0A1B0GTZ2

Expression Region

1-297

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTSGANSSGSYLPSEIRSSKIDDNYLKELNEDLKLRKQELLEMLKPLEDKNNLLFQKLMSNLEEKQRSLQIMRQIMAGKGCEESSVMELLKEAEEMKQNLERKNKMLRKEMEMLWNKTFEAEELSDQQKAPQTKNKADLQDGKAPKSPSSPRKTESELEKSFAEKVKEIRKEKQQRKMEWVKYQEQNNILQNDFHGKVIELRIEALKNYQKANDLKLSLYLQQNFEPMQAFLNLPGSQGTMGITTMDRVTTGRNEHHVRILGTKIYTEQQGTKGSQLDNTGGRLFFLRSLPDEALKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ER alpha Antibody
TA347123 50 µg

Mouse Monoclonal ER alpha Antibody

Sign In for Pricing
View Details
CBX1 Human qPCR Template Standard (NM_006807)
HK201670 1 Kit

CBX1 Human qPCR Template Standard (NM_006807)

Sign In for Pricing
View Details
Mob1b ORF Vector (Rat) (pORF)
ORF070672 1.0 µg DNA

Mob1b ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Human Alpha-Enolase (ENO1) CLIA Kit
abx190325-01 96 Tests

Human Alpha-Enolase (ENO1) CLIA Kit

Sign In for Pricing
View Details
Human Alpha-Enolase (ENO1) CLIA Kit
abx190325-02 5x 96 Tests

Human Alpha-Enolase (ENO1) CLIA Kit

Sign In for Pricing
View Details
Human Alpha-Enolase (ENO1) CLIA Kit
abx190325-03 10x 96 Tests

Human Alpha-Enolase (ENO1) CLIA Kit

Sign In for Pricing
View Details