Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 51 (TEX51), partial, Biotinylated

This Recombinant Human Testis-expressed protein 51 (TEX51), partial, Biotinylated spans the amino acid sequence from region 16-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 51 TEX51

UniProt

A0A1B0GUA7

Expression Region

16-137

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNCLRCWPELSALIDYDLQILWVTPGPPTELSQNRDHLEEETAKFFTQVHQAIKTLRDDKTVLLEEIYTHKNLFTERLNKISDGLKEKDIQSTLKVTSCADCRTHFLSCNDPTFCPARNRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 7-aminothieno[2,3-b]pyrazine-6-carboxylate
OR960335 1 g

Ethyl 7-aminothieno[2,3-b]pyrazine-6-carboxylate

Sign In for Pricing
View Details
DCLRE1C Protein Lysate (Human) with C-Ha Tag
17735032 100 µg

DCLRE1C Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
CCDC88A Antibody
orb674222-01 50 µg

CCDC88A Antibody

Sign In for Pricing
View Details
CCDC88A Antibody
orb674222-02 100 µg

CCDC88A Antibody

Sign In for Pricing
View Details
Nth Like DNA Glycosylase 1 Rabbit Monoclonal Antibody [KD Validation]
E51K3000 40 µL

Nth Like DNA Glycosylase 1 Rabbit Monoclonal Antibody [KD Validation]

Sign In for Pricing
View Details
Endoplasmin
AP83142 1 mg

Endoplasmin

Sign In for Pricing
View Details