Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 51 (TEX51), partial, Biotinylated

This Recombinant Human Testis-expressed protein 51 (TEX51), partial, Biotinylated spans the amino acid sequence from region 16-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 51 TEX51

UniProt

A0A1B0GUA7

Expression Region

16-137

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNCLRCWPELSALIDYDLQILWVTPGPPTELSQNRDHLEEETAKFFTQVHQAIKTLRDDKTVLLEEIYTHKNLFTERLNKISDGLKEKDIQSTLKVTSCADCRTHFLSCNDPTFCPARNRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine TNF Receptor Associated Factor 1 ELISA kit
GTR10429870 96 Well

Canine TNF Receptor Associated Factor 1 ELISA kit

Sign In for Pricing
View Details
CD31 (PECAM-1, Platelet gpIIa Molecule) (APC)
C2383-02B-APC 100 µL

CD31 (PECAM-1, Platelet gpIIa Molecule) (APC)

Sign In for Pricing
View Details
Med20 Mouse shRNA Plasmid (Locus ID 56771)
TR503264 1 Kit

Med20 Mouse shRNA Plasmid (Locus ID 56771)

Sign In for Pricing
View Details
Cyclophilin A Antibody [H11E16]
C21749-100uL*2 2x 100μL

Cyclophilin A Antibody [H11E16]

Sign In for Pricing
View Details
GM2 Ganglioside Activator (GM2A) DIY ELISA Kit
MBS2163286-01 5x 96 Tests

GM2 Ganglioside Activator (GM2A) DIY ELISA Kit

Sign In for Pricing
View Details
GM2 Ganglioside Activator (GM2A) DIY ELISA Kit
MBS2163286-02 5x 96 Tests + MBS2089471 (Support Pack 1,5x 96 Tests)

GM2 Ganglioside Activator (GM2A) DIY ELISA Kit

Sign In for Pricing
View Details