Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 51 (TEX51), partial, Biotinylated

This Recombinant Human Testis-expressed protein 51 (TEX51), partial, Biotinylated spans the amino acid sequence from region 16-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 51 TEX51

UniProt

A0A1B0GUA7

Expression Region

16-137

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNCLRCWPELSALIDYDLQILWVTPGPPTELSQNRDHLEEETAKFFTQVHQAIKTLRDDKTVLLEEIYTHKNLFTERLNKISDGLKEKDIQSTLKVTSCADCRTHFLSCNDPTFCPARNRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-FRS3 antibody
PAab03226 100 µg

Anti-FRS3 antibody

Sign In for Pricing
View Details
LYRM1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
27848064 1.0 µg DNA

LYRM1 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Methyl 2-Cyclohexyl-2-hydroxy-phenylacetate
M3398-32 2 g

Methyl 2-Cyclohexyl-2-hydroxy-phenylacetate

Sign In for Pricing
View Details
Quiloflex
MBS5783738 Inquire

Quiloflex

Sign In for Pricing
View Details
Interferon beta (IFN-beta, IFNb, IFB, IFF, IFNB1, Fibroblast Interferon, MGC96956) (Biotin)
I7662-10H-Biotin 100 µL

Interferon beta (IFN-beta, IFNb, IFB, IFF, IFNB1, Fibroblast Interferon, MGC96956) (Biotin)

Sign In for Pricing
View Details
PARP-11 Double Nickase Plasmid (m2)
sc-430361-NIC-2 20 µg

PARP-11 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details