Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 51 (TEX51), partial, Biotinylated

This Recombinant Human Testis-expressed protein 51 (TEX51), partial, Biotinylated spans the amino acid sequence from region 16-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 51 TEX51

UniProt

A0A1B0GUA7

Expression Region

16-137

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KNCLRCWPELSALIDYDLQILWVTPGPPTELSQNRDHLEEETAKFFTQVHQAIKTLRDDKTVLLEEIYTHKNLFTERLNKISDGLKEKDIQSTLKVTSCADCRTHFLSCNDPTFCPARNRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2- (3-Bromophenyl) -2-chloroacetamide
YZB29526-01 50 mg

2- (3-Bromophenyl) -2-chloroacetamide

Sign In for Pricing
View Details
2- (3-Bromophenyl) -2-chloroacetamide
YZB29526-02 0.5 g

2- (3-Bromophenyl) -2-chloroacetamide

Sign In for Pricing
View Details
Os05g0567500 Protein Rabbit Polyclonal Antibody
E580797-A-SE 100 µL

Os05g0567500 Protein Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
E-Selectin Mouse mAb, RBITC conjugated
orb2837987 100 µL

E-Selectin Mouse mAb, RBITC conjugated

Sign In for Pricing
View Details
Mag-Fluo-4 Tetrapotassium Salt
#50047 1x 500 µg

Mag-Fluo-4 Tetrapotassium Salt

Sign In for Pricing
View Details
HCG9P1 3'UTR GFP Stable Cell Line
TU059612 1.0 mL

HCG9P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details