Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein BRD3OS (BRDOS), Biotinylated

This Recombinant Human Uncharacterized protein BRD3OS (BRDOS), Biotinylated spans the amino acid sequence from region 1-84. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein BRD3OS; BRD3 opposite strand protein; Long intergenic non-protein coding RNA 94; Non-protein coding RNA 94; BRD3OS LINC00094 NCRNA00094 SERLOC

UniProt

A0A1B0GUI7

Expression Region

1-84

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSGRVPLAEKALSEGYARLRYRDTSLLIWQQQQQKLESVPPGTYLSRSRSMWYSQYGNEAILVRDKNKLEVSRDTGQSKFCTIM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Quinolineboronic Acid Pinacol Ester
426645-01 1 g

3-Quinolineboronic Acid Pinacol Ester

Sign In for Pricing
View Details
3-Quinolineboronic Acid Pinacol Ester
426645-02 2.5 g

3-Quinolineboronic Acid Pinacol Ester

Sign In for Pricing
View Details
UGT1A6 CRISPRa sgRNA lentivector (set of three targets)(Human)
49117121 3x 1.0µg DNA

UGT1A6 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
TGFb2) Mouse ELISA Kit
H5592 96 Tests

TGFb2) Mouse ELISA Kit

Sign In for Pricing
View Details
P40 phox Antibody (Phospho-Thr154) : HRP (OAAF07484-HRP)
OAAF07484-100UG-HRP 100 µg

P40 phox Antibody (Phospho-Thr154) : HRP (OAAF07484-HRP)

Sign In for Pricing
View Details
Goat Anti-Mouse IgG1 - AcalephFluor350
MBS8327806-01 0.1 mL

Goat Anti-Mouse IgG1 - AcalephFluor350

Sign In for Pricing
View Details