Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 48 (TEX48), Biotinylated

This Recombinant Human Testis-expressed protein 48 (TEX48), Biotinylated spans the amino acid sequence from region 1-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 48 TEX48

UniProt

A0A1B0GUV7

Expression Region

1-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAAHQNLILKIFCLCCRDCQEPYAINDSKVPSQTQEHKPSTQNLLLQKDELDRQNPKRINAVSHLPSRTPLIQTKKSTSSSSSEFEDLNAYASQRNFYKRNLNRYCQEHWPFQPCLTGRP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,4-Dichlorobenzene
TRC-D431875-50G 50 g

1,4-Dichlorobenzene

Sign In for Pricing
View Details
VGLUT1 Recombinant Chimeric Antibody Antibody
HA601478 100 µL

VGLUT1 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
KLF9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A9]
TA808446AM 100 µL

KLF9 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A9]

Sign In for Pricing
View Details
Barx2 Mouse Gene Knockout Kit (CRISPR)
KN501981 1 Kit

Barx2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Larixol
TRC-L175950-50MG 50 mg

Larixol

Sign In for Pricing
View Details
LARP1 Recombinant Rabbit monoclonal Antibody
HA723425 100 µL

LARP1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details