Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein SPMIP1 (SMIP1), Biotinylated

This Recombinant Human Protein SPMIP1 (SMIP1), Biotinylated spans the amino acid sequence from region 1-176. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein SPMIP1; ATP6V1F neighbor gene protein; Protein ATP6V1FNB; Sperm-associated microtubule inner protein 1; SPMIP1 ATP6V1FNB

UniProt

A0A1B0GUX0

Expression Region

1-176

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MSRQLNIDALRQNFWKEEYLREKMLRCEWYRKYGSMVKAKQKAKAAARLPLKLPTLHPKAPLSPPPAPKSAPSKVPSPVPEAPFQSEMYPVPPITRALLYEGISHDFQGRYRYLNTRKLDMPETRYLFPITTSFTYGWQLGPPVKQELVSCKMCRIESFFRKNGAFALLDPRDLAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFXANK, ID (RFXANK, ANKRA1, RFXB, DNA-binding protein RFXANK, Ankyrin repeat family A protein 1, Regulatory factor X subunit B, Regulatory factor X-associated ankyrin-containing protein) (MaxLight 650)
MBS6341573-01 0.1 mL

RFXANK, ID (RFXANK, ANKRA1, RFXB, DNA-binding protein RFXANK, Ankyrin repeat family A protein 1, Regulatory factor X subunit B, Regulatory factor X-associated ankyrin-containing protein) (MaxLight 650)

Sign In for Pricing
View Details
RFXANK, ID (RFXANK, ANKRA1, RFXB, DNA-binding protein RFXANK, Ankyrin repeat family A protein 1, Regulatory factor X subunit B, Regulatory factor X-associated ankyrin-containing protein) (MaxLight 650)
MBS6341573-02 5x 0.1 mL

RFXANK, ID (RFXANK, ANKRA1, RFXB, DNA-binding protein RFXANK, Ankyrin repeat family A protein 1, Regulatory factor X subunit B, Regulatory factor X-associated ankyrin-containing protein) (MaxLight 650)

Sign In for Pricing
View Details
Recombinant Glutaminyl tRNA Synthetase (QARS)
MBS2034467-01 0.01 mg

Recombinant Glutaminyl tRNA Synthetase (QARS)

Sign In for Pricing
View Details
Recombinant Glutaminyl tRNA Synthetase (QARS)
MBS2034467-02 0.05 mg

Recombinant Glutaminyl tRNA Synthetase (QARS)

Sign In for Pricing
View Details
Recombinant Glutaminyl tRNA Synthetase (QARS)
MBS2034467-03 0.1 mg

Recombinant Glutaminyl tRNA Synthetase (QARS)

Sign In for Pricing
View Details
Recombinant Glutaminyl tRNA Synthetase (QARS)
MBS2034467-04 0.2 mg

Recombinant Glutaminyl tRNA Synthetase (QARS)

Sign In for Pricing
View Details