Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MARCO-like protein (MRCOL), Biotinylated

This Recombinant Human MARCO-like protein (MRCOL), Biotinylated spans the amino acid sequence from region 21-285. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MARCO-like protein MARCOL

UniProt

A0A1B0GUY1

Expression Region

21-285

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QISNTSVFKLEENPKPALILEEKNEANHLGGQRDSNKQGGSYTQGNPGTFRLQGQPGYFNKLEKPRHFKQGRAGVLNQPGILKNSGKSNQKGNPESSNKQENSGSSSQLGRPGISTQQGNPGSSDQQEKPGSFSQKVMVGSSSQQGKPGSSSQHGNLGSSTQKGNLGSSSLQGHLGLSSHQGKPESSGQQGKPGSSSQQGNLGTSGQQEKPGSSSQQGKPGLSSHQGKPGSSSQQGNLHLSSQQGNQGPSSKQRKPGSSSRQGNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BXDC1 (RPF2) Rabbit Polyclonal Antibody
TA362777 100 µL

BXDC1 (RPF2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TSC22D1 (NM_183422) Human Tagged ORF Clone Lentiviral Particle
RC224087L4V 200 µL

TSC22D1 (NM_183422) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
PLV3-U6-PINK1-shRNA1-CopGFP-Puro Plasmid
PVT64996 2 µg

PLV3-U6-PINK1-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
DPP8 Antibody
orb677958 100 µL

DPP8 Antibody

Sign In for Pricing
View Details
Cfap65 (NM_001039495) Mouse Tagged ORF Clone
MG216441 10 µg

Cfap65 (NM_001039495) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cebpzos (NM_001177402) Mouse Tagged ORF Clone Lentiviral Particle
MR219551L3V 200 µL

Cebpzos (NM_001177402) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details