Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine protease-like protein 51 (PRS51), Biotinylated

This Recombinant Human Serine protease-like protein 51 (PRS51), Biotinylated spans the amino acid sequence from region 17-220. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Serine protease-like protein 51 PRSS51

UniProt

A0A1B0GVH4

Expression Region

17-220

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QDNPENVQCGHRPAFPNSSWLPFHERLQVQNGECPWQVSIQMSRKHLCGGSILHWWWVLTAAHCFRRTLLDMAVVNVTVVMGTRTFSNIHSERKQVQKEEERTWDWCWMAQWVTTNGYDQYDDLNMHLEKLRVVQISRKECAKRINQLSRNMICAWNEPGTNGIFKVLTPAQPPPPSRETVGHLWFVLFMEPRDSSKWVSSVGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Interleukin 8 / IL8 (CXCL8) Protein
abx261531-01 5 µg

Monkey Interleukin 8 / IL8 (CXCL8) Protein

Sign In for Pricing
View Details
Monkey Interleukin 8 / IL8 (CXCL8) Protein
abx261531-02 25 µg

Monkey Interleukin 8 / IL8 (CXCL8) Protein

Sign In for Pricing
View Details
Monkey Interleukin 8 / IL8 (CXCL8) Protein
abx261531-03 1 mg

Monkey Interleukin 8 / IL8 (CXCL8) Protein

Sign In for Pricing
View Details
IFI30 Protein Vector (Rat) (pPM-C-HA)
24218026 500 ng

IFI30 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
TBRG1 Rabbit Polyclonal Antibody (Biotin)
orb2097091 100 µL

TBRG1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
RNF150 Antibody
orb1266211 400 μl

RNF150 Antibody

Sign In for Pricing
View Details