Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein FAM240A (F240A), Biotinylated

This Recombinant Human Protein FAM240A (F240A), Biotinylated spans the amino acid sequence from region 1-83. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein FAM240A FAM240A

UniProt

A0A1B0GVK7

Expression Region

1-83

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRLFSGMNNQYTRREVFCRNTCHDLKHFWEREIGKQTYYRESEERRLGRSALRKLREEWKQRLETKLRLRNNPEDTEKRTNVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RN5S11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
39663111 3x 1.0 µg

RN5S11 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
PTGR1 Human Over-expression Lysate
orb1347542 100 µg

PTGR1 Human Over-expression Lysate

Sign In for Pricing
View Details
Fish Anti-C Reactive Protein Antibody ELISA Kit
MBS072783 Inquire

Fish Anti-C Reactive Protein Antibody ELISA Kit

Sign In for Pricing
View Details
NDUFAB1 Polyclonal Antibody
MBS2522659-01 0.02 mL

NDUFAB1 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFAB1 Polyclonal Antibody
MBS2522659-02 0.06 mL

NDUFAB1 Polyclonal Antibody

Sign In for Pricing
View Details
NDUFAB1 Polyclonal Antibody
MBS2522659-03 0.12 mL

NDUFAB1 Polyclonal Antibody

Sign In for Pricing
View Details