Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C11orf97 (CK097), Biotinylated

This Recombinant Human Uncharacterized protein C11orf97 (CK097), Biotinylated spans the amino acid sequence from region 1-126. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein C11orf97 C11orf97

UniProt

A0A1B0GVM6

Expression Region

1-126

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTGEEAVVVTAVVAPKAGREEEQPPPPAGLGCGARGEPGRGPLEHGQQWKKFLYCEPHKRIKEVLEEERHIKRDECHIKNPAAVALEGIWSIKRNLPVGGLKPGLPSRNSLLPQAKYYSRHGGLRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL
BNC400853-100 1x 100 µL

P34 / cdk1 (POH-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(3Beta,9Beta,10Alpha)-3-Hydroxy-pregna-5,7-dien-20-one
TRC-H952275-2.5MG 2.5 mg

(3Beta,9Beta,10Alpha)-3-Hydroxy-pregna-5,7-dien-20-one

Sign In for Pricing
View Details
TFCP2L1 Rabbit Polyclonal Antibody
R1307-8 100 µL

TFCP2L1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ALDH4A1 (NM_003748) Human Recombinant Protein
TP320893M 100 µg

ALDH4A1 (NM_003748) Human Recombinant Protein

Sign In for Pricing
View Details
Human KRTAP27-1 activation kit by CRISPRa
GA118707 1 Kit

Human KRTAP27-1 activation kit by CRISPRa

Sign In for Pricing
View Details
Dr1 (NM_026106) Mouse Tagged ORF Clone
MG201545 10 µg

Dr1 (NM_026106) Mouse Tagged ORF Clone

Sign In for Pricing
View Details