Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human LITAF domain-containing protein (LITAD), Biotinylated

This Recombinant Human LITAF domain-containing protein (LITAD), Biotinylated spans the amino acid sequence from region 1-72. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LITAF domain-containing protein; LITAF-like protein; LITAFD

UniProt

A0A1B0GVX0

Expression Region

1-72

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MPVQAVCPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFYYHRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2RSP HDR Plasmid (h)
sc-417827-HDR 20 µg

H2RSP HDR Plasmid (h)

Sign In for Pricing
View Details
PAGE5 Antibody
orb1269379 400 μl

PAGE5 Antibody

Sign In for Pricing
View Details
CSRP3 Antibody
orb2682408-01 50 µL

CSRP3 Antibody

Sign In for Pricing
View Details
CSRP3 Antibody
orb2682408-02 100 µL

CSRP3 Antibody

Sign In for Pricing
View Details
CSRP3 Antibody
orb2682408-03 200 µL

CSRP3 Antibody

Sign In for Pricing
View Details
Coupling Factor 6 Precursor amide, aa55-108, Human (CF 6)
301948 100 µg

Coupling Factor 6 Precursor amide, aa55-108, Human (CF 6)

Sign In for Pricing
View Details