Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small integral membrane protein 44 (SMI44), partial, Biotinylated

This Recombinant Human Small integral membrane protein 44 (SMI44), partial, Biotinylated spans the amino acid sequence from region 57-149. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small integral membrane protein 44 SMIM44

UniProt

A0A286YF18

Expression Region

57-149

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

HLIKDLAHDLADWAFGPKPDQEAAPRELRPSLTGEDLEGLDLQLALAWQGEEDAGGGGEGAPSEPPPPPEPRRPSIAFKDPPSRSSFWKLMAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Benzene-1,3-disulfonyl Chloride
MBS6114928-01 10 g

Benzene-1,3-disulfonyl Chloride

Sign In for Pricing
View Details
Benzene-1,3-disulfonyl Chloride
MBS6114928-02 5x 10 g

Benzene-1,3-disulfonyl Chloride

Sign In for Pricing
View Details
Akt2 (phospho Ser474) Polyclonal Antibody
E44H00455 100 µL

Akt2 (phospho Ser474) Polyclonal Antibody

Sign In for Pricing
View Details
SUMO4 3'UTR Lenti-reporter-Luc Vector
45883081 1.0 µg

SUMO4 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Neutral Red Stain Solution, 0.1%
G1316-01 100 mL

Neutral Red Stain Solution, 0.1%

Sign In for Pricing
View Details
Neutral Red Stain Solution, 0.1%
G1316-02 500 mL

Neutral Red Stain Solution, 0.1%

Sign In for Pricing
View Details