Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small cysteine and glycine repeat-containing protein 3 (SCGR3), Biotinylated

This Recombinant Human Small cysteine and glycine repeat-containing protein 3 (SCGR3), Biotinylated spans the amino acid sequence from region 1-100. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small cysteine and glycine repeat-containing protein 3; Keratin-associated protein 28-3; SCYGR3 KRTAP28-3

UniProt

A0A286YF60

Expression Region

1-100

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGCCGCGSCGGCGGGCGGCGGGCGGGCGGGCGGVCGSCTTCRCYRVGCCSSCCPCCRGCCGGCCSTPVICCCRRTCRSCGCGCRKGCCQQKCCCQKQCCC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Imazethapyr
TRC-I268625-25G 25 g

Imazethapyr

Sign In for Pricing
View Details
Chromogranin A (LK2H10 + PHE5 + CGA414), CF640R conjugate, 0.1mg/mL
BNC401223-500 1x 500 µL

Chromogranin A (LK2H10 + PHE5 + CGA414), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CCL3 / MIP-1 alpha Recombinant Rabbit monoclonal Antibody
HA751406 100 µL

CCL3 / MIP-1 alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), Biotin conjugate, 0.1mg/mL
BNCB1408-100 1x 100 µL

Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cystatin SN (CST1) (NM_001898) Human Over-expression Lysate
LY419671 100 µg

Cystatin SN (CST1) (NM_001898) Human Over-expression Lysate

Sign In for Pricing
View Details
Bis(4-hydroxyphenyl) Sulfone O-beta-D-Glucuronide Sodium Salt
TRC-B447395-1MG 1 mg

Bis(4-hydroxyphenyl) Sulfone O-beta-D-Glucuronide Sodium Salt

Sign In for Pricing
View Details