Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Oocyte-secreted protein 4B (OSP4B), Biotinylated

This Recombinant Human Oocyte-secreted protein 4B (OSP4B), Biotinylated spans the amino acid sequence from region 14-160. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Oocyte-secreted protein 4B OOSP4B

UniProt

A0A2R8Y4Y8

Expression Region

14-160

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SDDWLLVRMKIRPFDKNTDIRIGDIHLRDNCPVTRLLSFNYAFSYPVTSCGIKKIMFQTNDDAILSEISYKPRLHTTYEFPVVCFVKRLKFPSVMHFGMSGFDAHTLKEIPQKTKGQESPTPTQSKTWTLNFNSVNKEQLSKKSLYQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL
BNC470149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-500 1x 500 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF770 conjugate, 0.1mg/mL
BNC701052-500 1x 500 µL

CD3e (B-B12), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL
BNC740181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details