Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative PWWP domain-containing DNA repair factor 4 (PWWP4), partial, Biotinylated

This Recombinant Human Putative PWWP domain-containing DNA repair factor 4 (PWWP4), partial, Biotinylated spans the amino acid sequence from region 1756-1817. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative PWWP domain-containing DNA repair factor 4 PWWP4

UniProt

A0A494C071

Expression Region

1756-1817

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RGTMVWFKFQDHPFWPAVVKSVSNTDKTARVLLLEANLHHGKRGIQVPLRRLKHLDCKEKEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL
BNC941073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
BNC882216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF568 conjugate, 0.1mg/mL
BNC681577-100 1x 100 µL

Cytokeratin, Acidic (Type I or LMW) (Epithelial Marker) (KRTL/1577R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2115), CF740 conjugate, 0.1mg/mL
BNC742115-500 1x 500 µL

Cytokeratin 8 (KRT8) (KRT8/2115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), CF568 conjugate, 0.1mg/mL
BNC681408-500 1x 500 µL

Calponin-1 (Smooth Muscle Marker) (CNN1/1408R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), 1mg/mL
BNUM0679-50 1x 50 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), 1mg/mL

Sign In for Pricing
View Details