Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative PWWP domain-containing DNA repair factor 4 (PWWP4), partial, Biotinylated

This Recombinant Human Putative PWWP domain-containing DNA repair factor 4 (PWWP4), partial, Biotinylated spans the amino acid sequence from region 1756-1817. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative PWWP domain-containing DNA repair factor 4 PWWP4

UniProt

A0A494C071

Expression Region

1756-1817

Origin

Homo sapiens (Human)

Field of Research

Molecular Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RGTMVWFKFQDHPFWPAVVKSVSNTDKTARVLLLEANLHHGKRGIQVPLRRLKHLDCKEKEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FASLG Protein, His Tag
E40KMPH6561 20 µg

Human FASLG Protein, His Tag

Sign In for Pricing
View Details
Recombinant Pseudomonas sp. Cyanuric acid amidohydrolase (atzD)
orb1785428-01 20 µg

Recombinant Pseudomonas sp. Cyanuric acid amidohydrolase (atzD)

Sign In for Pricing
View Details
Recombinant Pseudomonas sp. Cyanuric acid amidohydrolase (atzD)
orb1785428-02 100 µg

Recombinant Pseudomonas sp. Cyanuric acid amidohydrolase (atzD)

Sign In for Pricing
View Details
Recombinant Pseudomonas sp. Cyanuric acid amidohydrolase (atzD)
orb1785428-03 1 mg

Recombinant Pseudomonas sp. Cyanuric acid amidohydrolase (atzD)

Sign In for Pricing
View Details
Recombinant Human TAC1 Protein, N-His-SUMO
orb2833703-01 20 µg

Recombinant Human TAC1 Protein, N-His-SUMO

Sign In for Pricing
View Details
Recombinant Human TAC1 Protein, N-His-SUMO
orb2833703-02 50 µg

Recombinant Human TAC1 Protein, N-His-SUMO

Sign In for Pricing
View Details