Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human CUB domain-containing protein (SPADH), Biotinylated

This Recombinant Human CUB domain-containing protein (SPADH), Biotinylated spans the amino acid sequence from region 22-137. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CUB domain-containing protein SPADH

UniProt

A0A494C103

Expression Region

22-137

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PFATAPSDCGGHYTDEYGRIFNYAGPKTECVWIIELNPGEIVTVAIPDLKGFACGKEYVEVLDGPPGSESLDRICKAFSTFYYSSSNIITIKYSREPSHPPTFFEIYYFVDAWSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRMP-5 (F-4) P
sc-376921 P 100 µg - 0.5 mL

CRMP-5 (F-4) P

Sign In for Pricing
View Details
Mouse Monoclonal PACT Antibody (1B9-1A7)
H00008575-M01 0.1 mg

Mouse Monoclonal PACT Antibody (1B9-1A7)

Sign In for Pricing
View Details
Mouse Relaxin ELISA Kit
MBS723860-01 48 Well

Mouse Relaxin ELISA Kit

Sign In for Pricing
View Details
Mouse Relaxin ELISA Kit
MBS723860-02 96 Well

Mouse Relaxin ELISA Kit

Sign In for Pricing
View Details
Mouse Relaxin ELISA Kit
MBS723860-03 5x 96 Well

Mouse Relaxin ELISA Kit

Sign In for Pricing
View Details
Mouse Relaxin ELISA Kit
MBS723860-04 10x 96 Well

Mouse Relaxin ELISA Kit

Sign In for Pricing
View Details