Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Speedy protein E9 (SPD9), Biotinylated

This Recombinant Human Speedy protein E9 (SPD9), Biotinylated spans the amino acid sequence from region 1-265. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Speedy protein E9 SPDYE9

UniProt

A0A494C191

Expression Region

1-265

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVSGPSAPGVDPSPPRRSLGWKRKRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQNIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVSLEELEEIQAYDPEHWVWARDRAHLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dermorphin Trifluoroacetic Acid Salt
TRC-D281940-5MG 5 mg

Dermorphin Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
cis-3-Benzoylcyclohexane-1-carboxylic Acid
TRC-C475953-500MG 500 mg

cis-3-Benzoylcyclohexane-1-carboxylic Acid

Sign In for Pricing
View Details
Human SHD activation kit by CRISPRa
GA111304 1 Kit

Human SHD activation kit by CRISPRa

Sign In for Pricing
View Details
Dicyclohexyl Phthalate
TRC-D439250-50G 50 g

Dicyclohexyl Phthalate

Sign In for Pricing
View Details
Sandalore (90%)
TRC-S115308-500MG 500 mg

Sandalore (90%)

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (139H2), CF488A conjugate, 0.1mg/mL
BNC880925-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (139H2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details