Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CEBPZOS (CEBOS), partial, Biotinylated

This Recombinant Human Protein CEBPZOS (CEBOS), partial, Biotinylated spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein CEBPZOS; CEBPZ antisense RNA 1; CEBPZ opposite strand; CEBPZOS CEBPZ-AS1

UniProt

A8MTT3

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQKTWLNSKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Veraguensin
TRC-V122300-2.5MG 2.5 mg

Veraguensin

Sign In for Pricing
View Details
D-a-Tocopherol Quinone
TRC-T526210-1G 1 g

D-a-Tocopherol Quinone

Sign In for Pricing
View Details
TOMM22 Rabbit Polyclonal Antibody
TA382699 100 µL

TOMM22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: bilateral
CS804757 5x 5 µm

Tissue FFPE Sections, Ovary: bilateral

Sign In for Pricing
View Details
4-Hydroxythieno[2,3-d]pyrimidine
TRC-H961750-2G 2 g

4-Hydroxythieno[2,3-d]pyrimidine

Sign In for Pricing
View Details
Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF405S conjugate, 0.1mg/mL
BNC043803-100 1x 100 µL

Human IgM (Immunoglobulin Mu Heavy Chain) (B-Cell Marker) (IGHM/3803R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details