Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein CEBPZOS (CEBOS), partial, Biotinylated

This Recombinant Human Protein CEBPZOS (CEBOS), partial, Biotinylated spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein CEBPZOS; CEBPZ antisense RNA 1; CEBPZ opposite strand; CEBPZOS CEBPZ-AS1

UniProt

A8MTT3

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KMHTSQDFRQTMSKKYPFILEVYYKSTEKSGMYGIRELDQKTWLNSKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Purified Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283A-01 25 µg

Purified Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
Purified Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283A-02 100 µg

Purified Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
ALDH3B2 (NM_001031615) Human Over-expression Lysate
LC422213 20 µg

ALDH3B2 (NM_001031615) Human Over-expression Lysate

Sign In for Pricing
View Details
c20orf72 (MGME1) Human Gene Knockout Kit (CRISPR)
KN203886 1 Kit

c20orf72 (MGME1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
N-L-Gamma-GLUTAMYL-L-LEUCINE
TRC-G245140-10MG 10 mg

N-L-Gamma-GLUTAMYL-L-LEUCINE

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR562952 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details