Recombinant Human UBAP1-MVB12-associated (UMAD1), Biotinylated
This Recombinant Human UBAP1-MVB12-associated (UMAD1), Biotinylated spans the amino acid sequence from region 1-137. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
UBAP1-MVB12-associated; UMA-domain containing protein 1; RPA3 antisense RNA 1; RPA3 opposite strand; UMAD1 RPA3-AS1 RPA3OS
UniProt
C9J7I0
Expression Region
1-137
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![PKA R2 (PRKAR2A) Mouse Monoclonal Antibody [Clone 1F8]](https://cdn.genprice.uk/genprice/uk/genprice4.webp)
E45M09762V-2 50 µL
PKA R2 (PRKAR2A) Mouse Monoclonal Antibody [Clone 1F8]
Sign In for Pricing
View Details 
MBS8101983-01 25 Tests
Recombinant Anti-CD64 Antibody (PerCP), Rabbit Monoclonal
Sign In for Pricing
View Details MBS8101983-02 100 Tests
Recombinant Anti-CD64 Antibody (PerCP), Rabbit Monoclonal
Sign In for Pricing
View Details MBS8101983-03 5x 100 Tests
Recombinant Anti-CD64 Antibody (PerCP), Rabbit Monoclonal
Sign In for Pricing
View Details 
251500-ML490 100 µL
SENP3 (SUMO1/sentrin/SMT3 Specific Peptidase 3, DKFZp586K0919, DKFZp762A152, SMT3IP1, SSP3) (MaxLight 490)
Sign In for Pricing
View Details