Recombinant Human UBAP1-MVB12-associated (UMAD1), Biotinylated
This Recombinant Human UBAP1-MVB12-associated (UMAD1), Biotinylated spans the amino acid sequence from region 1-137. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
UBAP1-MVB12-associated; UMA-domain containing protein 1; RPA3 antisense RNA 1; RPA3 opposite strand; UMAD1 RPA3-AS1 RPA3OS
UniProt
C9J7I0
Expression Region
1-137
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
MFHFFRKPPESKKPSVPETEADGFVLLGDTTDEQRMTARGKTSDIEANQPLETNKENSSSVTVSDPEMENKAGQTLENSSLMAELLSDVPFTLAPHVLAVQGTITDLPDHLLSYDGSENLSRFWYDFTLENSVLCDS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
YLA2129HU-01 48 Tests
Human soluble platelet-selectin, sP-selectin ELISA Kit
Sign In for Pricing
View Details YLA2129HU-02 96 Tests
Human soluble platelet-selectin, sP-selectin ELISA Kit
Sign In for Pricing
View Details 
O8056-04M-ML490 100 µL
OSTF1 (Osteoclast-stimulating Factor 1) (MaxLight 490)
Sign In for Pricing
View Details