Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial, Biotinylated

This Recombinant Human Nuclear pore complex-interacting protein family member B4 (NPIB4), partial, Biotinylated spans the amino acid sequence from region 1-62. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear pore complex-interacting protein family member B4 NPIPB4

UniProt

C9JG80

Expression Region

1-62

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3 Antibody [OKT3] (FITC)
76-247 100 Tests

CD3 Antibody [OKT3] (FITC)

Sign In for Pricing
View Details
CKIP-1 Overexpression Lysate (Native) - (Dry Ice)
NBL1-14512 0.1 mg

CKIP-1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
ORC1 (7F6/1), CF740 conjugate, 0.1mg/mL
BNC743067-100 1x 100 µL

ORC1 (7F6/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cts3 Protein Vector (Mouse) (pPM-C-HA)
17089024 500 ng

Cts3 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
HMG20A (NM_018200) Human Over-expression Lysate
LS010363-100ug 100 µg

HMG20A (NM_018200) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Cytokeratin 19
DB 103-0.2 200 µL

Anti-Cytokeratin 19

Sign In for Pricing
View Details