Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex-interacting protein family member B11 (NPB11), partial, Biotinylated

This Recombinant Human Nuclear pore complex-interacting protein family member B11 (NPB11), partial, Biotinylated spans the amino acid sequence from region 1-62. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear pore complex-interacting protein family member B11 NPIPB11

UniProt

E5RHQ5

Expression Region

1-62

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a
C2262-02T 100 µg

CD11a

Sign In for Pricing
View Details
USF1 Antibody
OACA03922-100UG 100 µg

USF1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal LILRA1/LILRB1 Antibody (586326) [DyLight 405]
FAB30851E 0.1 mL

Mouse Monoclonal LILRA1/LILRB1 Antibody (586326) [DyLight 405]

Sign In for Pricing
View Details
PLGRKT Antibody; HRP conjugated
MBS7001518-01 0.05 mg

PLGRKT Antibody; HRP conjugated

Sign In for Pricing
View Details
PLGRKT Antibody; HRP conjugated
MBS7001518-02 0.1 mg

PLGRKT Antibody; HRP conjugated

Sign In for Pricing
View Details
PLGRKT Antibody; HRP conjugated
MBS7001518-03 5x 0.1 mg

PLGRKT Antibody; HRP conjugated

Sign In for Pricing
View Details