Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial, Biotinylated

This Recombinant Human Uroplakin-3b-like protein 2 (UPKL2), partial, Biotinylated spans the amino acid sequence from region 34-204. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uroplakin-3b-like protein 2 UPK3BL2

UniProt

E5RIL1

Expression Region

34-204

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GTDVAAPEHISYVPQLSNDTLAGRLTLSTFTLEQPLGQFSSHNISDLDTIWLVVALSNATQSFTAPRTNQDIPAPANFSQRGYYLTLRANRVLYQTRGQLHVLRVGNDTHCQPTKIGCNHPLPGPGPYRVKFLVMNDEGPVAETKWSSDTRLQQAQALRAVPGPQSPGTVV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGF Antibody (Biotin)
orb431898 50 µg

EGF Antibody (Biotin)

Sign In for Pricing
View Details
Collagen VI (COL6A3) (NM_057165) Human Untagged Clone
SC305745 10 µg

Collagen VI (COL6A3) (NM_057165) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant Botryotinia fuckeliana Neutral protease 2 homolog SNOG_10522 (BC1G_10098)
MBS1247030-01 0.02 mg (E-Coli)

Recombinant Botryotinia fuckeliana Neutral protease 2 homolog SNOG_10522 (BC1G_10098)

Sign In for Pricing
View Details
Recombinant Botryotinia fuckeliana Neutral protease 2 homolog SNOG_10522 (BC1G_10098)
MBS1247030-02 0.1 mg (E-Coli)

Recombinant Botryotinia fuckeliana Neutral protease 2 homolog SNOG_10522 (BC1G_10098)

Sign In for Pricing
View Details
Recombinant Botryotinia fuckeliana Neutral protease 2 homolog SNOG_10522 (BC1G_10098)
MBS1247030-03 0.02 mg (Yeast)

Recombinant Botryotinia fuckeliana Neutral protease 2 homolog SNOG_10522 (BC1G_10098)

Sign In for Pricing
View Details
Recombinant Botryotinia fuckeliana Neutral protease 2 homolog SNOG_10522 (BC1G_10098)
MBS1247030-04 0.1 mg (Yeast)

Recombinant Botryotinia fuckeliana Neutral protease 2 homolog SNOG_10522 (BC1G_10098)

Sign In for Pricing
View Details