Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nuclear pore complex-interacting protein family member B12 (NPB12), partial, Biotinylated

This Recombinant Human Nuclear pore complex-interacting protein family member B12 (NPB12), partial, Biotinylated spans the amino acid sequence from region 1-72. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear pore complex-interacting protein family member B12 NPIPB12

UniProt

F8W0I5

Expression Region

1-72

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MVKLSIVLTPQFLSHDQGQLTKELQQHVKSVTCPCEYLRKVINTLADHHHRGTDFGGSPWLHVIIAFPTSYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AP2S1 Recombinant Antibody, PerCP Conjugated
bsm-61180R-PerCP-TR 20 µL

AP2S1 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Flna shRNA (UAS) - Lentiviral mouse Flna shRNA (UAS, iRFP) (100)
GTR15232335 1 Vial

Lentiviral mouse Flna shRNA (UAS) - Lentiviral mouse Flna shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
Human IL-17D protein
orb755608-01 50 µg

Human IL-17D protein

Sign In for Pricing
View Details
Human IL-17D protein
orb755608-02 100 µg

Human IL-17D protein

Sign In for Pricing
View Details
Human IL-17D protein
orb755608-03 200 µg

Human IL-17D protein

Sign In for Pricing
View Details
Human IL-17D protein
orb755608-04 1 mg

Human IL-17D protein

Sign In for Pricing
View Details