Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079), Biotinylated

This Recombinant Human Uncharacterized protein encoded by LINC01619 (CL079), Biotinylated spans the amino acid sequence from region 1-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Uncharacterized protein encoded by LINC01619 LINC01619 C12orf79

UniProt

G3V211

Expression Region

1-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MNVCCSSHPVNEKVWKPSSRKWSSKVWSMDEFDLQTACYWFMTRCQKEAGKFGTHRGKPMCFVRSLLRVQLLPRTFPANSFVISFFPSLIYPLQVYQLHFESSDKQRAMQFVTEG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thrombomodulin (THBD) Mouse Monoclonal Antibody [Clone ID: B-A35]
AM31356AF-N 200 µg

Thrombomodulin (THBD) Mouse Monoclonal Antibody [Clone ID: B-A35]

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR560468 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
BCKDHA (C-term) Rabbit Polyclonal Antibody
AP17149PU-N 400 µL

BCKDHA (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS640461 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
Pyruvate Dehydrogenase E2 Antibody
KC-6122-01 50 μL

Pyruvate Dehydrogenase E2 Antibody

Sign In for Pricing
View Details
Pyruvate Dehydrogenase E2 Antibody
KC-6122-02 100 µL

Pyruvate Dehydrogenase E2 Antibody

Sign In for Pricing
View Details