Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3), Biotinylated

This Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3), Biotinylated spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3; Rhodanese domain-containing protein 3; TSTD3

UniProt

H0UI37

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLDEVGEALQMNPRDFKEKYNEVKPSKSDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL
BNC040345-500 1x 500 µL

CD4 (EDU-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF488A conjugate, 0.1mg/mL
BNC880851-500 1x 500 µL

HSP60 (LK1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD47 (IAP/964), CF594 conjugate, 0.1mg/mL
BNC940964-500 1x 500 µL

CD47 (IAP/964), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF405S conjugate, 0.1mg/mL
BNC040159-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (GP1.4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF740 conjugate, 0.1mg/mL
BNC740039-500 1x 500 µL

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details