Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3), Biotinylated

This Recombinant Human Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3 (TSTD3), Biotinylated spans the amino acid sequence from region 1-97. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thiosulfate sulfurtransferase/rhodanese-like domain-containing protein 3; Rhodanese domain-containing protein 3; TSTD3

UniProt

H0UI37

Expression Region

1-97

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MKIEKCGWSEGLTSIKGNCHNFYTAISKDVTYKELKNLLNSKNIMLIDVREIWEILEYQKIPESINVPLDEVGEALQMNPRDFKEKYNEVKPSKSDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Hp shRNA (UAS) - Lentiviral mouse Hp shRNA (UAS, iRFP) (25)
GTR15288374 1 Vial

Lentiviral mouse Hp shRNA (UAS) - Lentiviral mouse Hp shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Anti-PILRA Antibody Picoband® Fluoro647 Conjugated
A07502-1-Fluoro647 100 µg/Vial

Anti-PILRA Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Tmem45a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4901407 1.0 µg DNA

Tmem45a sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human parainfluenza virus RT PCR kit
RTq-H445-150R 150T

Human parainfluenza virus RT PCR kit

Sign In for Pricing
View Details
RPL31 Antibody
CSB-PA020227GA01HU 100 µL

RPL31 Antibody

Sign In for Pricing
View Details
Kallikrein 12 (KLK12) CytoSection
TS419330P5 25 Slides

Kallikrein 12 (KLK12) CytoSection

Sign In for Pricing
View Details