Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human MKRN2 opposite strand protein (MKROS), Biotinylated

This Recombinant Human MKRN2 opposite strand protein (MKROS), Biotinylated spans the amino acid sequence from region 1-223. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MKRN2 opposite strand protein; MKRN2 antisense RNA 1; MKRN2 antisense gene protein 1; MKRN2OS C3orf83 MKRN2-AS1

UniProt

H3BPM6

Expression Region

1-223

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80��C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MHCAEAGKALIKFNHCEKYIYSFSVPQCCPLCQQDLGSRKLEDAPVSIANPFTNGHQEKCSFLLRPTQGTFLREYDGRSDLHVGITNTNGVVYNYSAHGVQRDGEGWEESISIPLLQPNMYGMMEQWDKYLEDFSTSGAWLPHRYEDNHHNCYSYALTFINCVLMAEGRQQLDKGEFTEKYVVPRTRLASKFITLYRAIREHGFYVTDCPQQQAQPPEGGGLC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bulk Anti-Human CD45 (T29/33) Antibody
ICH1173-1mg 1 mg

Bulk Anti-Human CD45 (T29/33) Antibody

Sign In for Pricing
View Details
MIR3914-2 Human MicroRNA Expression Plasmid (MI0016421)
SC401512 10 µg

MIR3914-2 Human MicroRNA Expression Plasmid (MI0016421)

Sign In for Pricing
View Details
Toll-like receptor 9 antibody (biotin)
61R-1671 50 ug

Toll-like receptor 9 antibody (biotin)

Sign In for Pricing
View Details
Lentiviral human OGA sgRNA gene knockout kit - Lentiviral human OGA sgRNA gene knockout kit (100)
GTR15378823 1 Vial

Lentiviral human OGA sgRNA gene knockout kit - Lentiviral human OGA sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
MGluR3 Rabbit mAb
RDSA66119 100 µL

MGluR3 Rabbit mAb

Sign In for Pricing
View Details
CST2 Antibody
OACD02779-100UL 100 µL

CST2 Antibody

Sign In for Pricing
View Details