Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Small leucine-rich protein 1 (SMLR1), partial, Biotinylated

This Recombinant Human Small leucine-rich protein 1 (SMLR1), partial, Biotinylated spans the amino acid sequence from region 74-107. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Small leucine-rich protein 1 SMLR1

UniProt

H3BR10

Expression Region

74-107

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RIKLIEVNEELSQNCDRQHNPKDGSSLYQRMKWT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDSUB1 Rabbit Polyclonal Antibody
TA330512 100 µL

WDSUB1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DHX30 Polyclonal Antibody, Biotin Conjugated
bs-14313R-Biotin 100 µL

DHX30 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
CheKine Micro Urease Activity Assay Kit
orb3148191-01 48 Tests

CheKine Micro Urease Activity Assay Kit

Sign In for Pricing
View Details
CheKine Micro Urease Activity Assay Kit
orb3148191-02 96 Tests

CheKine Micro Urease Activity Assay Kit

Sign In for Pricing
View Details
Water Genomic DNA Purification kit(Spin Column)
2539B 100 Tests

Water Genomic DNA Purification kit(Spin Column)

Sign In for Pricing
View Details
HSPA14 (G-9) Alexa Fluor® 790
sc-398208 AF790 200 µg/mL

HSPA14 (G-9) Alexa Fluor® 790

Sign In for Pricing
View Details