Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 178B (T178B), partial, Biotinylated

This Recombinant Human Transmembrane protein 178B (T178B), partial, Biotinylated spans the amino acid sequence from region 24-171. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 178B TMEM178B

UniProt

H3BS89

Expression Region

24-171

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VAICSDHWYETDARKHRDRCKAFNTRRVDPGFIYNNNNNLPLRASRSRLDRWEGKLLRARNRRQLFAMSPADECSRQYNSTNMGLWRKCHRQGFDPEIAALIRKGEIERCTYIKYHYSSATIPRNLTFNITKTIRQDEWHALHLRRMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENTPD4 (NM_004901) Human Recombinant Protein
TP314422M 100 µg

ENTPD4 (NM_004901) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometrium
CS802544 5x 5 µm

Tissue FFPE Sections, Endometrium

Sign In for Pricing
View Details
Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3025), CF647 conjugate, 0.1mg/mL
BNC473025-500 1x 500 µL

Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3025), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P15 INK Antibody
8C0287-AAT 50 µg

P15 INK Antibody

Sign In for Pricing
View Details
FITC Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116C-01 50 Tests

FITC Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details
FITC Anti-Mouse CD49b/pan-NK cells Antibody[DX5]
E-AB-F1116C-02 100 Tests

FITC Anti-Mouse CD49b/pan-NK cells Antibody[DX5]

Sign In for Pricing
View Details