Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 178B (T178B), partial, Biotinylated

This Recombinant Human Transmembrane protein 178B (T178B), partial, Biotinylated spans the amino acid sequence from region 24-171. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 178B TMEM178B

UniProt

H3BS89

Expression Region

24-171

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VAICSDHWYETDARKHRDRCKAFNTRRVDPGFIYNNNNNLPLRASRSRLDRWEGKLLRARNRRQLFAMSPADECSRQYNSTNMGLWRKCHRQGFDPEIAALIRKGEIERCTYIKYHYSSATIPRNLTFNITKTIRQDEWHALHLRRMT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO22 (NM_147188) Human Recombinant Protein
TP760168 50 µg

FBXO22 (NM_147188) Human Recombinant Protein

Sign In for Pricing
View Details
Human CXXC5 activation kit by CRISPRa
GA109850 1 Kit

Human CXXC5 activation kit by CRISPRa

Sign In for Pricing
View Details
4933421I07Rik Mouse Gene Knockout Kit (CRISPR)
KN500451 1 Kit

4933421I07Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Crnde activation kit by CRISPRa
GA208788 1 Kit

Mouse Crnde activation kit by CRISPRa

Sign In for Pricing
View Details
C11orf49 Rabbit Polyclonal Antibody
TA370107 100 µL

C11orf49 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human CD19/Leu-12 Protein (Fc Tag)
PKSH032206-01 10 µg

Recombinant Human CD19/Leu-12 Protein (Fc Tag)

Sign In for Pricing
View Details