Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-expressed protein 46 (TEX46), partial, Biotinylated

This Recombinant Human Testis-expressed protein 46 (TEX46), partial, Biotinylated spans the amino acid sequence from region 37-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-expressed protein 46 TEX46 C1orf234

UniProt

H3BTG2

Expression Region

37-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

LSNWLVKYEHKLTLPEPQQDEILQRLLFSEMKMKVLENQMFIIWNKMNHHGRSSRHRNFPMKKHRMRRHESICPTLSDCTSSSPS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MSANTD1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV771292 1.0 µg DNA

MSANTD1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Human PCMTD1 Recombinant Protein
PROTQ96MG8-01 10 µg

Human PCMTD1 Recombinant Protein

Sign In for Pricing
View Details
Human PCMTD1 Recombinant Protein
PROTQ96MG8-02 250 µg

Human PCMTD1 Recombinant Protein

Sign In for Pricing
View Details
RIN2 Protein Vector (Mouse) (pPM-C-His)
PV224341 500 ng

RIN2 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Cyclin A1 Colorimetric Cell-Based ELISA Kit
MBS9500159-01 1 Kit

Cyclin A1 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details
Cyclin A1 Colorimetric Cell-Based ELISA Kit
MBS9500159-02 5x 1 Kit

Cyclin A1 Colorimetric Cell-Based ELISA Kit

Sign In for Pricing
View Details