Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 179 (CC179), Biotinylated

This Recombinant Human Coiled-coil domain-containing protein 179 (CC179), Biotinylated spans the amino acid sequence from region 1-68. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 179 CCDC179

UniProt

H3BU77

Expression Region

1-68

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MCLYCWDIEPSQVNPEGPRQHHPSEVTERQLANKRIQNMQHLKKEKRRLNKRFSRPSPIPEPGLLWSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIPK2, CT (Homeodomain Interacting Protein Kinase 2, hHIPk2, DKFZp686K02111, FLJ23711, PRO0593) (MaxLight 490) discontinued
H4065-10E-ML490 100 µL

HIPK2, CT (Homeodomain Interacting Protein Kinase 2, hHIPk2, DKFZp686K02111, FLJ23711, PRO0593) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Synaptophysin
HAR124-6ml 6 mL

Synaptophysin

Sign In for Pricing
View Details
LOC100039183 3'UTR Luciferase Stable Cell Line
TU111159 1.0 mL

LOC100039183 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ATP6V1E1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
12792111 3x 1.0 µg

ATP6V1E1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Heat shock 70 kDa protein 14 (HSPA14) Bovine ELISA Kit
D9480 96 Tests

Heat shock 70 kDa protein 14 (HSPA14) Bovine ELISA Kit

Sign In for Pricing
View Details
MEIS2 Rabbit pAb, BF700 conjugated
orb2857822 100 µL

MEIS2 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details