Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Claudin-34 (CLD34), partial, Biotinylated

This Recombinant Human Claudin-34 (CLD34), partial, Biotinylated spans the amino acid sequence from region 33-80. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Claudin-34 CLDN34

UniProt

H7C241

Expression Region

33-80

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EWRIWYMKDTSLYPPGIACVGIFRVCIYRRRTNSTTTKFCYRYSYQDT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Genorise® Universal DNA Mini Kit 500
GR101077-500 500 Preparations

Genorise® Universal DNA Mini Kit 500

Sign In for Pricing
View Details
N6-Succinyllysine
MBS5783109 Inquire

N6-Succinyllysine

Sign In for Pricing
View Details
IFT52 Polyclonal Antibody
ANT-12683-50ug 50 µg

IFT52 Polyclonal Antibody

Sign In for Pricing
View Details
Neuropilin 1 (NRP1) Human Over-expression Lysate
orb1343026 100 µg

Neuropilin 1 (NRP1) Human Over-expression Lysate

Sign In for Pricing
View Details
Canine TGF-beta receptor type-1 (TGFBR1) ELISA Kit
MBS2604086-01 48 Well

Canine TGF-beta receptor type-1 (TGFBR1) ELISA Kit

Sign In for Pricing
View Details
Canine TGF-beta receptor type-1 (TGFBR1) ELISA Kit
MBS2604086-02 96 Well

Canine TGF-beta receptor type-1 (TGFBR1) ELISA Kit

Sign In for Pricing
View Details