Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Coiled-coil domain-containing protein 188 (CC188), partial, Biotinylated

This Recombinant Human Coiled-coil domain-containing protein 188 (CC188), partial, Biotinylated spans the amino acid sequence from region 1-346. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 188 CCDC188

UniProt

H7C350

Expression Region

1-346

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEGLKTLGPCGHPHPQCPPTPASSSHGGGLDQPCQGFVGWPCLGPISSAHSVQSQRPFPVPGAGGSGPTVEGEAPGLFLSSQEQRARDTEGPRQGDLEAGLGWGWPLHPGSNQGAPRQGGSIGSGTRPCPCPPLSREGGALASPRVALSQLQCGLLGSAEQSFLQLEQENHSLKRQNQELREQLGALLGPGQQFLPLCPEHSSCTALAWPPDPAGTQPLGNRAPLQLLRRELCQGQEAFVQQSQNELQQIRLCFERKKMVITEVWDNVAEMHMALNNQATGLLNLKKDIRGVLDQMEDIQLEILRERAQCRTRARKEKQMASMSKGRPKLGSSKGLAGQLWLLTLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CACH3 Rabbit pAb, AP conjugated
orb2842571 100 µL

CACH3 Rabbit pAb, AP conjugated

Sign In for Pricing
View Details
Anti-IRAK4 Antibody Picoband® Fluoro488 Conjugated
A01247-3-Fluoro488 100 µg/Vial

Anti-IRAK4 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
Adgrg2 (NM_181366) Rat Tagged ORF Clone
RR202435 10 µg

Adgrg2 (NM_181366) Rat Tagged ORF Clone

Sign In for Pricing
View Details
Tsku sgRNA CRISPR Lentivector set (Mouse)
K4974601 3x 1.0 µg

Tsku sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Anti-Zebrafish TNFA Antibody Picoband® Fluoro488 Conjugated
AZQ08CQ3-Fluoro488 100 µg/Vial

Anti-Zebrafish TNFA Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
1-Nonanethiol
sc-237601 250 mg

1-Nonanethiol

Sign In for Pricing
View Details